Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse EEF1A lysine methyltransferase 2 (Eef1akmt2)

This Recombinant Mouse EEF1A lysine methyltransferase 2 (Eef1akmt2) spans the amino acid sequence from region 1-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EEF1A lysine methyltransferase 2 (EC 2.1.1.-) (Methyltransferase-like protein 10) (Protein-lysine N-methyltransferase Mettl10)

UniProt

Q9D853

Expression Region

1-244aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA22 CytoSection
TS429882P5 25 Slides

SPATA22 CytoSection

Sign In for Pricing
View Details
UBD 3'UTR GFP Stable Cell Line
TU077638 1.0 mL

UBD 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse Putative palmitoyltransferase ZDHHC22 (Zdhhc22)
MBS951681 Inquire

Recombinant Mouse Putative palmitoyltransferase ZDHHC22 (Zdhhc22)

Sign In for Pricing
View Details
RASSF4 Antibody
MBS7116944-01 0.05 mg

RASSF4 Antibody

Sign In for Pricing
View Details
RASSF4 Antibody
MBS7116944-02 0.1 mg

RASSF4 Antibody

Sign In for Pricing
View Details
RASSF4 Antibody
MBS7116944-03 5x 0.1 mg

RASSF4 Antibody

Sign In for Pricing
View Details