Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ribonuclease inhibitor (Rnh1), partial

This Recombinant Mouse Ribonuclease inhibitor (Rnh1), partial spans the amino acid sequence from region 2-456aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribonuclease inhibitor (Ribonuclease/angiogenin inhibitor 1)

UniProt

Q91VI7

Expression Region

2-456aa

Tag

N-terminal 6xHis-MBP-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

93.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLDIQCEQLSDARWTELLPLIQQYEVVRLDDCGLTEVRCKDISSAVQANPALTELSLRTNELGDGGVGLVLQGLQNPTCKIQKLSLQNCGLTEAGCGILPGMLRSLSTLRELHLNDNPMGDAGLKLLCEGLQDPQCRLEKLQLEYCNLTATSCEPLASVLRVKADFKELVLSNNDLHEPGVRILCQGLKDSACQLESLKLENCGITAANCKDLCDVVASKASLQELDLSSNKLGNAGIAALCPGLLLPSCKLRTLWLWECDITAEGCKDLCRVLRAKQSLKELSLASNELKDEGARLLCESLLEPGCQLESLWIKSCSLTAASCPYFCSVLTKSRSLLELQMSSNPLGDEGVQELCKALSQPDTVLRELWLGDCDVTNSGCSSLANVLLANRSLRELDLSNNCMGGPGVLQLLESLKQPSCTLQQLVLYDIYWTNEVEEQLRALEEERPSLRIIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC25 Protein Vector (Human) (pPM-C-His)
PV024296 500 ng

LRRC25 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mmu-miR-710 miRNA Inhibitor
CIM0312-01 10 nmol

Mmu-miR-710 miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-710 miRNA Inhibitor
CIM0312-02 20 nmol

Mmu-miR-710 miRNA Inhibitor

Sign In for Pricing
View Details
C7orf20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV809986 1.0 µg DNA

C7orf20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase II/CA2 Antibody Picoband® (Dylight550 Conjugate)
PB9989-Dylight550 100 µg

Anti-Carbonic Anhydrase II/CA2 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
DNAJC12, 1-198aa, Human, His tag, E Coli
MBS204413-01 0.01 mg

DNAJC12, 1-198aa, Human, His tag, E Coli

Sign In for Pricing
View Details