Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial

This Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial spans the amino acid sequence from region 860-1186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing factor 3B subunit 3 (Pre-mRNA-splicing factor SF3b 130 kDa subunit) (SF3b130) (Spliceosome-associated protein 130) (SAP 130)

UniProt

A0JN52

Expression Region

860-1186aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf18 Protein Vector (Human) (pPM-N-D-C-HA)
PV330708 500 ng

C2orf18 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Silver Nitrate 2.5L 0.1709N Dairy Testing
DAI1170 1 Each

Silver Nitrate 2.5L 0.1709N Dairy Testing

Sign In for Pricing
View Details
Mouse Heat Shock Protein 20 HSP-20 ELISA Kit
MBS721896-01 48 Well

Mouse Heat Shock Protein 20 HSP-20 ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock Protein 20 HSP-20 ELISA Kit
MBS721896-02 96 Well

Mouse Heat Shock Protein 20 HSP-20 ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock Protein 20 HSP-20 ELISA Kit
MBS721896-03 5x 96 Well

Mouse Heat Shock Protein 20 HSP-20 ELISA Kit

Sign In for Pricing
View Details
Mouse Heat Shock Protein 20 HSP-20 ELISA Kit
MBS721896-04 10x 96 Well

Mouse Heat Shock Protein 20 HSP-20 ELISA Kit

Sign In for Pricing
View Details