Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial

This Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial spans the amino acid sequence from region 23-230aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit alpha-7

UniProt

P36544

Expression Region

23-230aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Mitochondrial cardiolipin hydrolase Protein, His-SUMO, E.coli-10ug
QP7879-ec-10ug 10ug

Recombinant Human Mitochondrial cardiolipin hydrolase Protein, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:3 Sulfoxide reductase heme-binding subunit YedZ (yedZ)
orb2912582-01 20 µg

Recombinant Yersinia pseudotuberculosis serotype O:3 Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:3 Sulfoxide reductase heme-binding subunit YedZ (yedZ)
orb2912582-02 100 µg

Recombinant Yersinia pseudotuberculosis serotype O:3 Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Sign In for Pricing
View Details
ACY1 Over-expression Lysate Product
GWB-91C4FD 0.1 mg

ACY1 Over-expression Lysate Product

Sign In for Pricing
View Details
CYLD (NM_001042355) Human Tagged Lenti ORF Clone
RC204099L4 10 µg

CYLD (NM_001042355) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SEPHS2 CRISPR Activation Plasmid (h)
sc-406316-ACT 20 µg

SEPHS2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details