Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Egl nine homolog 1 (EGLN1), partial

This Recombinant Human Egl nine homolog 1 (EGLN1), partial spans the amino acid sequence from region 177-426aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Egl nine homolog 1 (EC 1.14.11.29) (Hypoxia-inducible factor prolyl hydroxylase 2) (HIF-PH2) (HIF-prolyl hydroxylase 2) (HPH-2) (Prolyl hydroxylase domain-containing protein 2) (PHD2) (SM-20)

UniProt

Q9GZT9

Expression Region

177-426aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Desulfitobacterium hafniense Cobalamin synthase (cobS), partial
MBS7075893 Inquire

Recombinant Desulfitobacterium hafniense Cobalamin synthase (cobS), partial

Sign In for Pricing
View Details
GTF2H2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0916506 1.0 µg DNA

GTF2H2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Chicken Vitamin D (VD) ELISA Kit
NSL0113Ch 96 Tests

Chicken Vitamin D (VD) ELISA Kit

Sign In for Pricing
View Details
WT1 Antibody [J23C5]
C22202-100uL*2 2x 100μL

WT1 Antibody [J23C5]

Sign In for Pricing
View Details
Bovine CGA / Glycoprotein hormones alpha chain Recombinant Protein
R0441b 1 Each

Bovine CGA / Glycoprotein hormones alpha chain Recombinant Protein

Sign In for Pricing
View Details
Polybead® Polystyrene Violet Dyed Microspheres 6.00µm
18136-5 5 mL

Polybead® Polystyrene Violet Dyed Microspheres 6.00µm

Sign In for Pricing
View Details