Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleosome assembly protein 1-like 4 (NAP1L4)

This Recombinant Human Nucleosome assembly protein 1-like 4 (NAP1L4) spans the amino acid sequence from region 2-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleosome assembly protein 1-like 4 (Nucleosome assembly protein 2) (NAP-2)

UniProt

Q99733

Expression Region

2-375aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SQSTM1 Rabbit Monoclonal Antibody [Clone ID: R08-4H8]
TA385315 100 µL

SQSTM1 Rabbit Monoclonal Antibody [Clone ID: R08-4H8]

Sign In for Pricing
View Details
Cilazapril
TRC-C441200-10MG 10 mg

Cilazapril

Sign In for Pricing
View Details
L-Glutamine-2,3,3,4,4-d5
TRC-G597005-2.5MG 2.5 mg

L-Glutamine-2,3,3,4,4-d5

Sign In for Pricing
View Details
TMEM168 Human Gene Knockout Kit (CRISPR)
KN420027 1 Kit

TMEM168 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stearidonic Acid
TRC-S686450-2.5MG 2.5 mg

Stearidonic Acid

Sign In for Pricing
View Details
TMIGD1 Human Gene Knockout Kit (CRISPR)
KN423761 1 Kit

TMIGD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details