Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Leghemoglobin C2

This Recombinant Glycine max Leghemoglobin C2 spans the amino acid sequence from region 2-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leghemoglobin C2

UniProt

P02236

Expression Region

2-145aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT81
CSB-CL823910HU1 10 μg Plasmid + 200 μL Glycerol

IFT81

Sign In for Pricing
View Details
CAV3 Adenovirus (Mouse)
15100054 1.0 mL

CAV3 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse ERK2 / MAPK1 / MAPK2 Protein (His & GST tag)
ARP6652-01 10 µg

Recombinant Mouse ERK2 / MAPK1 / MAPK2 Protein (His & GST tag)

Sign In for Pricing
View Details
Recombinant Mouse ERK2 / MAPK1 / MAPK2 Protein (His & GST tag)
ARP6652-02 50 µg

Recombinant Mouse ERK2 / MAPK1 / MAPK2 Protein (His & GST tag)

Sign In for Pricing
View Details
Recombinant Mouse ERK2 / MAPK1 / MAPK2 Protein (His & GST tag)
ARP6652-03 100 µg

Recombinant Mouse ERK2 / MAPK1 / MAPK2 Protein (His & GST tag)

Sign In for Pricing
View Details
Recombinant Mouse ERK2 / MAPK1 / MAPK2 Protein (His & GST tag)
ARP6652-04 1 mg

Recombinant Mouse ERK2 / MAPK1 / MAPK2 Protein (His & GST tag)

Sign In for Pricing
View Details