Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pyruvate dehydrogenase protein X component, mitochondrial (PDHX)

This Recombinant Human Pyruvate dehydrogenase protein X component, mitochondrial (PDHX) spans the amino acid sequence from region 54-501aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pyruvate dehydrogenase protein X component, mitochondrial (Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex) (E3-binding protein) (E3BP) (Lipoyl-containing pyruvate dehydrogenase complex component X) (proX)

UniProt

O00330

Expression Region

54-501aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIOK3P1 Protein Vector (Human) (pPB-C-His)
PV115818 500 ng

RIOK3P1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mouse ITGα5 (ITGα5) ELISA Kit
YP-W20831-01 48 Tests

Mouse ITGα5 (ITGα5) ELISA Kit

Sign In for Pricing
View Details
Mouse ITGα5 (ITGα5) ELISA Kit
YP-W20831-02 96 Tests

Mouse ITGα5 (ITGα5) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Scavenger receptor cysteine-rich domain-containing protein LOC284297 homolog , partial
MBS1280744-01 0.02 mg (E-Coli)

Recombinant Mouse Scavenger receptor cysteine-rich domain-containing protein LOC284297 homolog , partial

Sign In for Pricing
View Details
Recombinant Mouse Scavenger receptor cysteine-rich domain-containing protein LOC284297 homolog , partial
MBS1280744-02 0.1 mg (E-Coli)

Recombinant Mouse Scavenger receptor cysteine-rich domain-containing protein LOC284297 homolog , partial

Sign In for Pricing
View Details
Recombinant Mouse Scavenger receptor cysteine-rich domain-containing protein LOC284297 homolog , partial
MBS1280744-03 0.02 mg (Yeast)

Recombinant Mouse Scavenger receptor cysteine-rich domain-containing protein LOC284297 homolog , partial

Sign In for Pricing
View Details