Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2)

This Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2) spans the amino acid sequence from region 19-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leukocyte cell-derived chemotaxin-2 (LECT-2) (Chondromodulin II) (ChM-II)

UniProt

O88803

Expression Region

19-151aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Uncharacterized Protein C12orf56 (C12ORF56) ELISA Kit
MBS9398995 Inquire

Cat Uncharacterized Protein C12orf56 (C12ORF56) ELISA Kit

Sign In for Pricing
View Details
Hepatocellular carcinoma with normal tissue array, including pathology grade, TNM and clinical stage, 40 cases/80 cores
DLV8013 40 Cases / 80 Cores

Hepatocellular carcinoma with normal tissue array, including pathology grade, TNM and clinical stage, 40 cases/80 cores

Sign In for Pricing
View Details
96 well, white, TC treated, sterile
PYB-96-W-TC 1pcs/box, 100 boxes/ctn

96 well, white, TC treated, sterile

Sign In for Pricing
View Details
IgG, H&L, X-Adsorbed
MBS614507-01 1.5 mg

IgG, H&L, X-Adsorbed

Sign In for Pricing
View Details
IgG, H&L, X-Adsorbed
MBS614507-02 5x 1.5 mg

IgG, H&L, X-Adsorbed

Sign In for Pricing
View Details
SPHK2 Conjugated Antibody
MBS9446698-01 0.1 mL (Biotin)

SPHK2 Conjugated Antibody

Sign In for Pricing
View Details