Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Appetite-regulating hormone (Ghrl)

This Recombinant Mouse Appetite-regulating hormone (Ghrl) spans the amino acid sequence from region 24-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Appetite-regulating hormone (Growth hormone secretagogue) (Growth hormone-releasing peptide) (Motilin-related peptide) (Protein M46) [Cleaved into, Ghrelin, Obestatin]

UniProt

Q9EQX0

Expression Region

24-117aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XpressTM Human ASGR1 Over-expressing Stable Cell Line (HEK-293)
ABC-X0027F 1 Vial

XpressTM Human ASGR1 Over-expressing Stable Cell Line (HEK-293)

Sign In for Pricing
View Details
Bovine Complement Component 7 ELISA kit
GTR10374024 96 Well

Bovine Complement Component 7 ELISA kit

Sign In for Pricing
View Details
HRP Conjugated, IgG SABC (Streptavidin-Biotin Complex) Detection Kit (Human) discontinued
352898 1 Kit

HRP Conjugated, IgG SABC (Streptavidin-Biotin Complex) Detection Kit (Human) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal NF-H Antibody (SPM145) [DyLight 755]
NBP2-47668IR 0.1 mL

Mouse Monoclonal NF-H Antibody (SPM145) [DyLight 755]

Sign In for Pricing
View Details
FAM196B Double Nickase Plasmid (m)
sc-436866-NIC 20 µg

FAM196B Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Mouse Neuropeptide S ELISA Kit
MBS2885927-01 48 Well

Mouse Neuropeptide S ELISA Kit

Sign In for Pricing
View Details