Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS)

This Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS) spans the amino acid sequence from region 30-341aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglubulin-degrading enzyme

UniProt

F8V4V0

Expression Region

30-341aa

Tag

C-terminal 11xHis-tagged

Source

E.coli

Origin

Streptococcus pyogenes

Field of Research

Protein Biochemistry

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant OTX2 Antibody
RC-16005-01 50 μL

Recombinant OTX2 Antibody

Sign In for Pricing
View Details
Recombinant OTX2 Antibody
RC-16005-02 100 µL

Recombinant OTX2 Antibody

Sign In for Pricing
View Details
Recombinant OTX2 Antibody
RC-16005-03 1 mL

Recombinant OTX2 Antibody

Sign In for Pricing
View Details
Rhodamine-123
TRC-R318585-25MG 25 mg

Rhodamine-123

Sign In for Pricing
View Details
PSMG2 (C-term) Rabbit Polyclonal Antibody
AP53488PU-N 400 µL

PSMG2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), CF740 conjugate, 0.1mg/mL
BNC743149-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details