Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Nucleoprotein (N)

This Recombinant Bovine coronavirus Nucleoprotein (N) spans the amino acid sequence from region 1-448aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein, NC, Protein N

UniProt

P59712

Expression Region

1-448aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Bovine coronavirus (strain Quebec) (BCoV) (BCV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PER2 Antibody, Biotin conjugated
CSB-PA017787LD01HU-01 50 μL

PER2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PER2 Antibody, Biotin conjugated
CSB-PA017787LD01HU-02 100 µL

PER2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rat Accn1 ELISA Kit
ELI-49448r 96 Tests

Rat Accn1 ELISA Kit

Sign In for Pricing
View Details
NAT10 Antibody
22-840 100 µL

NAT10 Antibody

Sign In for Pricing
View Details
REEP6 shRNA Plasmid (h)
sc-97151-SH 20 µg

REEP6 shRNA Plasmid (h)

Sign In for Pricing
View Details
SNX5P2 Protein Vector (Human) (pPM-C-HA)
PV132636 500 ng

SNX5P2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details