Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial

This Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial spans the amino acid sequence from region 33-262aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Csf1, CsfmMacrophage colony-stimulating factor 1, CSF-1, MCSF) [Cleaved into, Processed macrophage colony-stimulating factor 1]

UniProt

P07141

Expression Region

33-262aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A (TIMM8A) Antibody
abx116211 100 µL

Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A (TIMM8A) Antibody

Sign In for Pricing
View Details
RPL30 Blocking Peptide
abx063214-01 1 mg

RPL30 Blocking Peptide

Sign In for Pricing
View Details
RPL30 Blocking Peptide
abx063214-02 5 mg

RPL30 Blocking Peptide

Sign In for Pricing
View Details
Anti-TGIF/TGIF1 Antibody Picoband®, PE Conjugate
A04122-1-PE 100 µg/Vial

Anti-TGIF/TGIF1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
SHISA2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV651183 1.0 µg DNA

SHISA2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Tau (Ab-235) Antibody
MBS852794-01 0.1 mg

Tau (Ab-235) Antibody

Sign In for Pricing
View Details