Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2AX (H2AFX)

This Recombinant Human Histone H2AX (H2AFX) spans the amino acid sequence from region 1-143aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2A.X

UniProt

P16104

Expression Region

1-143aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-neutrophil cytoplasmic antibody ELISA Kit
GTR10366873 96 Well

Mouse Anti-neutrophil cytoplasmic antibody ELISA Kit

Sign In for Pricing
View Details
CD11a antibody (PE-CY7)
61R-CD11PE7 0.1 mg

CD11a antibody (PE-CY7)

Sign In for Pricing
View Details
p164-RhoGEF Polyclonal Antibody
MBS8524475-01 0.1 mg

p164-RhoGEF Polyclonal Antibody

Sign In for Pricing
View Details
p164-RhoGEF Polyclonal Antibody
MBS8524475-02 0.1 mL (AF635)

p164-RhoGEF Polyclonal Antibody

Sign In for Pricing
View Details
p164-RhoGEF Polyclonal Antibody
MBS8524475-03 0.1 mL (AF610)

p164-RhoGEF Polyclonal Antibody

Sign In for Pricing
View Details
p164-RhoGEF Polyclonal Antibody
MBS8524475-04 0.1 mL (AF405S)

p164-RhoGEF Polyclonal Antibody

Sign In for Pricing
View Details