Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain-derived neurotrophic factor (BDNF)

This Recombinant Human Brain-derived neurotrophic factor (BDNF) spans the amino acid sequence from region 19-247aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Abrineurin

UniProt

P23560

Expression Region

19-247aa

Tag

N-terminal 6xHis-Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMBRD1 Protein Lysate (Rat) with C-HA Tag
26899036 100 µg

LMBRD1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
STRN4 Recombinant Protein Antigen
NBP2-49234PEP 0.1 mL

STRN4 Recombinant Protein Antigen

Sign In for Pricing
View Details
CAPON (NOS1AP) Human Over-expression Lysate
orb1341231 100 µg

CAPON (NOS1AP) Human Over-expression Lysate

Sign In for Pricing
View Details
RNF23 (m) -PR
sc-155964-PR 10 µM - 20 µL

RNF23 (m) -PR

Sign In for Pricing
View Details
Human Synaptotagmin XIII (SYT13) ELISA Kit
201-12-2576 96 Tests

Human Synaptotagmin XIII (SYT13) ELISA Kit

Sign In for Pricing
View Details
Marimastat
orb1226126-01 200 mg

Marimastat

Sign In for Pricing
View Details