Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calmodulin regulator protein PCP4 (Pcp4)

This Recombinant Mouse Calmodulin regulator protein PCP4 (Pcp4) spans the amino acid sequence from region 1-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain-specific antigen PCP-4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4)

UniProt

P63054

Expression Region

1-62aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSERQSAGATNGKDKTSGDNDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CDAN1 Protein, His (Fc)-Avi-tagged
CDAN1-1476M 50 µg

Recombinant Mouse CDAN1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Lentiviral mouse Speer4d shRNA (UAS) - Lentiviral mouse Speer4d shRNA (UAS, GFP) (100)
GTR15115137 1 Vial

Lentiviral mouse Speer4d shRNA (UAS) - Lentiviral mouse Speer4d shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CARD16 Antibody (Biotin)
orb687571-01 50 μL

CARD16 Antibody (Biotin)

Sign In for Pricing
View Details
CARD16 Antibody (Biotin)
orb687571-02 100 µL

CARD16 Antibody (Biotin)

Sign In for Pricing
View Details
PIK3IP1 Antibody, FITC conjugated
A64856-50UG 50 µg

PIK3IP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
TM2D2 Blocking Peptide
33R-7531 100 ug

TM2D2 Blocking Peptide

Sign In for Pricing
View Details