Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sortase A (srtA), partial

This Recombinant Staphylococcus aureus Sortase A (srtA), partial spans the amino acid sequence from region 25-206aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Surface protein sorting A

UniProt

Q2FV99

Expression Region

25-206aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain NCTC 8325)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JDP2 Antibody
orb1259619 100 µL

JDP2 Antibody

Sign In for Pricing
View Details
ENPP4 siRNA (Human)
MBS8215207-01 15 nmol

ENPP4 siRNA (Human)

Sign In for Pricing
View Details
ENPP4 siRNA (Human)
MBS8215207-02 30 nmol

ENPP4 siRNA (Human)

Sign In for Pricing
View Details
ENPP4 siRNA (Human)
MBS8215207-03 5x 30 nmol

ENPP4 siRNA (Human)

Sign In for Pricing
View Details
Skepinone-L
B1110-5 5 mg

Skepinone-L

Sign In for Pricing
View Details
Aminomalonic acid
T5244-01 25 mg

Aminomalonic acid

Sign In for Pricing
View Details