Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial

This Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial spans the amino acid sequence from region 19-134aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic polypeptide receptor

UniProt

Q0P543

Expression Region

19-134aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam22 (Cytoplasm.) Mouse Monoclonal Antibody [Clone ID: N46/30]
75-083 100 µL

Adam22 (Cytoplasm.) Mouse Monoclonal Antibody [Clone ID: N46/30]

Sign In for Pricing
View Details
Rfc3 Mouse Gene Knockout Kit (CRISPR)
KN514690 1 Kit

Rfc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cortactin pTyr466 Rabbit Polyclonal Antibody
AP02517PU-S 50 µL

Cortactin pTyr466 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SGI-1027
TRC-S282375-5MG 5 mg

SGI-1027

Sign In for Pricing
View Details
GPR85 (NM_001146266) Human Over-expression Lysate
LY431878 100 µg

GPR85 (NM_001146266) Human Over-expression Lysate

Sign In for Pricing
View Details
rac-Hesperetin 3’,7-Diglucuronide
TRC-H289535-1MG 1 mg

rac-Hesperetin 3’,7-Diglucuronide

Sign In for Pricing
View Details