Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial

This Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial spans the amino acid sequence from region 19-134aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic polypeptide receptor

UniProt

Q0P543

Expression Region

19-134aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A9]
TA802408BM 100 µL

CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A9]

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS633308 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
Recombinant PHOX2B Antibody
RC-16331-01 50 μL

Recombinant PHOX2B Antibody

Sign In for Pricing
View Details
Recombinant PHOX2B Antibody
RC-16331-02 100 µL

Recombinant PHOX2B Antibody

Sign In for Pricing
View Details
Recombinant PHOX2B Antibody
RC-16331-03 1 mL

Recombinant PHOX2B Antibody

Sign In for Pricing
View Details
PDHB (NM_001173468) Human Over-expression Lysate
LC432907 20 µg

PDHB (NM_001173468) Human Over-expression Lysate

Sign In for Pricing
View Details