Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisomal biogenesis factor 3 (PEX3), partial

This Recombinant Human Peroxisomal biogenesis factor 3 (PEX3), partial spans the amino acid sequence from region 141-373aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peroxin-3 (Peroxisomal assembly protein PEX3)

UniProt

P56589

Expression Region

141-373aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY6G6C Antibody, HRP conjugated
A27845-100UG 100 µg

LY6G6C Antibody, HRP conjugated

Sign In for Pricing
View Details
2-Amino-3-ethylbenzoic acid
FAA43740-01 0.5 g

2-Amino-3-ethylbenzoic acid

Sign In for Pricing
View Details
2-Amino-3-ethylbenzoic acid
FAA43740-02 5 g

2-Amino-3-ethylbenzoic acid

Sign In for Pricing
View Details
pCMV-SPORT6-Cyrib Plasmid
PVT46268 2 µg

pCMV-SPORT6-Cyrib Plasmid

Sign In for Pricing
View Details
HSP90B1 Heat Shock Protein 90kDa Beta (GRP94) Member 1 Human Recombinant Protein
PROTP14625-1 10 µg

HSP90B1 Heat Shock Protein 90kDa Beta (GRP94) Member 1 Human Recombinant Protein

Sign In for Pricing
View Details
ANXA2 Chemi-Luminescent ELISA Kit (Human) (OKCD03298)
OKCD03298 96 Well

ANXA2 Chemi-Luminescent ELISA Kit (Human) (OKCD03298)

Sign In for Pricing
View Details