Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisomal biogenesis factor 3 (PEX3), partial

This Recombinant Human Peroxisomal biogenesis factor 3 (PEX3), partial spans the amino acid sequence from region 141-373aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peroxin-3 (Peroxisomal assembly protein PEX3)

UniProt

P56589

Expression Region

141-373aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM196B Double Nickase Plasmid (m2)
sc-436866-NIC-2 20 µg

FAM196B Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Zika virus NS1 Protein
P1064-10 10 µg

Recombinant Zika virus NS1 Protein

Sign In for Pricing
View Details
CHPT1 Lentiviral Activation Particles (h)
sc-412745-LAC 200 µL

CHPT1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
SUFU polyclonal antibody
BS91299 50ul

SUFU polyclonal antibody

Sign In for Pricing
View Details
FAM91A3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0737306 1.0 µg DNA

FAM91A3P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Keratin 13 (KRT13) ELISA Kit
RDR-KRT13-Hu-01 96 Tests

Human Keratin 13 (KRT13) ELISA Kit

Sign In for Pricing
View Details