Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-1 protein (GJA1), partial

This Recombinant Human Gap junction alpha-1 protein (GJA1), partial spans the amino acid sequence from region 233-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein)

UniProt

P17302

Expression Region

233-382aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRAS Antibody: HRP
MBS8001412-01 0.1 mg

HRAS Antibody: HRP

Sign In for Pricing
View Details
HRAS Antibody: HRP
MBS8001412-02 5x 0.1 mg

HRAS Antibody: HRP

Sign In for Pricing
View Details
Human APOC3 knockdown cell line
ABC-KD0819 1 Vial

Human APOC3 knockdown cell line

Sign In for Pricing
View Details
Diclofenac Acyl-Beta-D-glucuronide Allyl Ester
TRC-D436485-2.5MG 2.5 mg

Diclofenac Acyl-Beta-D-glucuronide Allyl Ester

Sign In for Pricing
View Details
OR7E155P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1540507 1.0 µg DNA

OR7E155P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
NOTCH2, CT (Notch 2, Notch 2 homolog, Notch homolog 2, Notch homolog-2) (MaxLight 405) discontinued
301427-ML405 100 µL

NOTCH2, CT (Notch 2, Notch 2 homolog, Notch homolog 2, Notch homolog-2) (MaxLight 405) discontinued

Sign In for Pricing
View Details