Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-1 protein (GJA1), partial

This Recombinant Human Gap junction alpha-1 protein (GJA1), partial spans the amino acid sequence from region 233-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein)

UniProt

P17302

Expression Region

233-382aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.X (H2AFX) Human qPCR Template Standard (NM_002105)
HK203605 1 Kit

Histone H2A.X (H2AFX) Human qPCR Template Standard (NM_002105)

Sign In for Pricing
View Details
GSK3 beta Antibody (PE/ATTO 594)
abx449196 100 µg

GSK3 beta Antibody (PE/ATTO 594)

Sign In for Pricing
View Details
Olr1456 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
33954156 3x 1.0 µg DNA

Olr1456 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
3,5-Di-tert-butylphenol
MBS3616659-01 500 mg

3,5-Di-tert-butylphenol

Sign In for Pricing
View Details
3,5-Di-tert-butylphenol
MBS3616659-02 5x 500 mg

3,5-Di-tert-butylphenol

Sign In for Pricing
View Details
hsa-miR-3170 miRNA Antagomir
MBS8316902-01 10 nmol

hsa-miR-3170 miRNA Antagomir

Sign In for Pricing
View Details