Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-1 protein (GJA1), partial

This Recombinant Human Gap junction alpha-1 protein (GJA1), partial spans the amino acid sequence from region 233-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein)

UniProt

P17302

Expression Region

233-382aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO7 Antibody
C44539-01 50 µL

LMO7 Antibody

Sign In for Pricing
View Details
LMO7 Antibody
C44539-02 100 µL

LMO7 Antibody

Sign In for Pricing
View Details
RBM5 ORF Vector (Human) (pORF)
38642011 1.0 µg DNA

RBM5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Porcine HK ELISA Kit
EPH0325 96 Tests

Porcine HK ELISA Kit

Sign In for Pricing
View Details
2- (1-Naphthyloxy) propanohydrazide
sc-304398 500 mg

2- (1-Naphthyloxy) propanohydrazide

Sign In for Pricing
View Details
Rabbit Polyclonal DOCK7 Antibody
NBP1-78749 100 µL

Rabbit Polyclonal DOCK7 Antibody

Sign In for Pricing
View Details