Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-1 protein (GJA1), partial

This Recombinant Human Gap junction alpha-1 protein (GJA1), partial spans the amino acid sequence from region 233-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein)

UniProt

P17302

Expression Region

233-382aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD133 (PROM1) Mouse Monoclonal Antibody [Clone ID: LBI4A8]
AMM21207VCF 100 µg

CD133 (PROM1) Mouse Monoclonal Antibody [Clone ID: LBI4A8]

Sign In for Pricing
View Details
Rabbit Polyclonal SCD-2 Antibody
NBP3-10121-100ul 100 µL

Rabbit Polyclonal SCD-2 Antibody

Sign In for Pricing
View Details
Nelarabine
018058 10 mg

Nelarabine

Sign In for Pricing
View Details
PKD1P4 sgRNA CRISPR Lentivector set (Human)
K1655801 3x 1.0 µg

PKD1P4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC66 Antibody [PerCP]
NBP1-78739PCP 0.1 mL

Rabbit Polyclonal CCDC66 Antibody [PerCP]

Sign In for Pricing
View Details
Nck (NCK1) Human Gene Knockout Kit (CRISPR)
KN402869 1 Kit

Nck (NCK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details