Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Colicin-E5 (col), partial

This Recombinant Escherichia coli Colicin-E5 (col), partial spans the amino acid sequence from region 74-180aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P18000

Expression Region

74-180aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAKNKGKIPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKNDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6β-Hydroxy Norethindrone Acetate
013322 5 mg

6β-Hydroxy Norethindrone Acetate

Sign In for Pricing
View Details
Rabbit Anti-CALRL/CALCRL Polyclonal Antibody
PAV648 100 μL

Rabbit Anti-CALRL/CALCRL Polyclonal Antibody

Sign In for Pricing
View Details
MonoMethyl-Histone H3-K79 Rabbit pAb
E45R28878N-50 50 µL

MonoMethyl-Histone H3-K79 Rabbit pAb

Sign In for Pricing
View Details
TSHZ3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
48568126 3x 1.0µg DNA

TSHZ3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
TBX1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-21501R-BF680 100 µL

TBX1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
ST18 Polyclonal Antibody, FITC Conjugated
bs-12188R-FITC-01 20 µL

ST18 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details