Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Colicin-E5 (col), partial

This Recombinant Escherichia coli Colicin-E5 (col), partial spans the amino acid sequence from region 74-180aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P18000

Expression Region

74-180aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAKNKGKIPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKNDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Chicken IgG (H&L) Antibody (APC)
orb1878768-01 100 µL

Goat Anti-Chicken IgG (H&L) Antibody (APC)

Sign In for Pricing
View Details
Goat Anti-Chicken IgG (H&L) Antibody (APC)
orb1878768-02 500 µL

Goat Anti-Chicken IgG (H&L) Antibody (APC)

Sign In for Pricing
View Details
Goat Anti-Chicken IgG (H&L) Antibody (APC)
orb1878768-03 1 mL

Goat Anti-Chicken IgG (H&L) Antibody (APC)

Sign In for Pricing
View Details
Paqr5 Mouse siRNA Oligo Duplex (Locus ID 74090)
SR410241 1 Kit

Paqr5 Mouse siRNA Oligo Duplex (Locus ID 74090)

Sign In for Pricing
View Details
REEP6 (NM_138393) Human Recombinant Protein
TP302159 20 µg

REEP6 (NM_138393) Human Recombinant Protein

Sign In for Pricing
View Details
Rimegepant Impurity 89
RM-R102089-01 10 mg

Rimegepant Impurity 89

Sign In for Pricing
View Details