Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD9 antigen (Cd9)

This Recombinant Mouse CD9 antigen (Cd9) spans the amino acid sequence from region 1-226aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P40240

Expression Region

1-226aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAPGEF6 Rabbit Polyclonal Antibody (HRP)
orb2090852 100 µL

RAPGEF6 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Hamster Pancreatic Amylase ELISA Kit
MBS036133-01 48 Well

Hamster Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details
Hamster Pancreatic Amylase ELISA Kit
MBS036133-02 96 Well

Hamster Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details
Hamster Pancreatic Amylase ELISA Kit
MBS036133-03 5x 96 Well

Hamster Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details
Hamster Pancreatic Amylase ELISA Kit
MBS036133-04 10x 96 Well

Hamster Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details
KLHDC7B CRISPRa sgRNA lentivector (set of three targets)(Human)
25769121 3x 1.0µg DNA

KLHDC7B CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details