Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD9 antigen (Cd9)

This Recombinant Mouse CD9 antigen (Cd9) spans the amino acid sequence from region 1-226aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P40240

Expression Region

1-226aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 14 Antibody (KRT14/4131) [Janelia Fluor 669]
NBP3-20723JF669 0.1 mL

Mouse Monoclonal Cytokeratin 14 Antibody (KRT14/4131) [Janelia Fluor 669]

Sign In for Pricing
View Details
Human Complement 1q (C1q) ELISA Kit
orb1947742-01 48 Tests

Human Complement 1q (C1q) ELISA Kit

Sign In for Pricing
View Details
Human Complement 1q (C1q) ELISA Kit
orb1947742-02 96 Tests

Human Complement 1q (C1q) ELISA Kit

Sign In for Pricing
View Details
Amyloid P antibody
10R-A126A 0.1 mg

Amyloid P antibody

Sign In for Pricing
View Details
LEF1, GST-Tag, Recombinant (TCF10, TCF7L3, FLJ46390, TCF1ALPHA, DKFZp586H0919, LEF-1, Lymphoid Enhancer-Binding Factor 1) discontinued
500809 200 µg

LEF1, GST-Tag, Recombinant (TCF10, TCF7L3, FLJ46390, TCF1ALPHA, DKFZp586H0919, LEF-1, Lymphoid Enhancer-Binding Factor 1) discontinued

Sign In for Pricing
View Details
C4orf3 Polyclonal Antibody, FITC Conjugated
A56821-050 50 µL

C4orf3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details