Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated

This Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated spans the amino acid sequence from region 22-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-11

UniProt

P20808

Expression Region

22-199aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MAP4K6 Antibody
NBP2-49220 0.1 mL

Rabbit Polyclonal MAP4K6 Antibody

Sign In for Pricing
View Details
Human COPS3 Pre-designed siRNA Set A
SI003457A 1 Each

Human COPS3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CDYL (CDYL1, Chromodomain Protein) (MaxLight 550)
MBS6445586-01 0.1 mL

CDYL (CDYL1, Chromodomain Protein) (MaxLight 550)

Sign In for Pricing
View Details
CDYL (CDYL1, Chromodomain Protein) (MaxLight 550)
MBS6445586-02 5x 0.1 mL

CDYL (CDYL1, Chromodomain Protein) (MaxLight 550)

Sign In for Pricing
View Details
Ly6h ORF Vector (Mouse) (pORF)
ORF049572 1.0 µg DNA

Ly6h ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RGD1311703 (NM_001013898) Rat Tagged ORF Clone Lentiviral Particle
RR203364L4V 200 µL

RGD1311703 (NM_001013898) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details