Recombinant Avian infectious bronchitis virus Non-structural protein 5b (5b)
This Recombinant Avian infectious bronchitis virus Non-structural protein 5b (5b) spans the amino acid sequence from region 1-82aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ns5b, Accessory protein 5b
UniProt
P19745
Expression Region
1-82aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Avian infectious bronchitis virus (strain KB8523) (IBV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
10.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MNNSKDNPFRGAIARKARIYLREGLDCVYFLNKAGQAEPCPACTSLVFQGKTCEEHIHNNNLLSWQVVRQLERQTPQRQSSN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
