Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Non-structural protein 5b (5b)

This Recombinant Avian infectious bronchitis virus Non-structural protein 5b (5b) spans the amino acid sequence from region 1-82aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ns5b, Accessory protein 5b

UniProt

P19745

Expression Region

1-82aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain KB8523) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNNSKDNPFRGAIARKARIYLREGLDCVYFLNKAGQAEPCPACTSLVFQGKTCEEHIHNNNLLSWQVVRQLERQTPQRQSSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itpripl1 (NM_001163528) Mouse Tagged ORF Clone
MR217249 10 µg

Itpripl1 (NM_001163528) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LIMS2 siRNA (Human)
CRJ0827-01 15 nmol

LIMS2 siRNA (Human)

Sign In for Pricing
View Details
LIMS2 siRNA (Human)
CRJ0827-02 30 nmol

LIMS2 siRNA (Human)

Sign In for Pricing
View Details
Mouse Cold-inducible RNA-binding protein (CIRBP) ELISA kit
CSB-EL005440MO-01 48 Tests

Mouse Cold-inducible RNA-binding protein (CIRBP) ELISA kit

Sign In for Pricing
View Details
Mouse Cold-inducible RNA-binding protein (CIRBP) ELISA kit
CSB-EL005440MO-02 96 Tests

Mouse Cold-inducible RNA-binding protein (CIRBP) ELISA kit

Sign In for Pricing
View Details
Mouse Cold-inducible RNA-binding protein (CIRBP) ELISA kit
CSB-EL005440MO-03 5x 96 Tests

Mouse Cold-inducible RNA-binding protein (CIRBP) ELISA kit

Sign In for Pricing
View Details