Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)

This Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT) spans the amino acid sequence from region 29-361aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutaminyl cyclase , QC , sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase , EC

UniProt

Q16769

Expression Region

29-361aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Col27a1 qPCR Primer Pair
QM72262S 200 Tests

Mouse Col27a1 qPCR Primer Pair

Sign In for Pricing
View Details
1-{3-[2- (3-Acetylphenoxy) ethoxy]phenyl}ethan-1-one
MEA09259-01 0.5 g

1-{3-[2- (3-Acetylphenoxy) ethoxy]phenyl}ethan-1-one

Sign In for Pricing
View Details
1-{3-[2- (3-Acetylphenoxy) ethoxy]phenyl}ethan-1-one
MEA09259-02 5 g

1-{3-[2- (3-Acetylphenoxy) ethoxy]phenyl}ethan-1-one

Sign In for Pricing
View Details
Tissue Total RNA, Parathyroid gland
CR559547 5 µg

Tissue Total RNA, Parathyroid gland

Sign In for Pricing
View Details
FGF12 discontinued
381217 200 µL

FGF12 discontinued

Sign In for Pricing
View Details
CD81 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-6934R-BF488-01 20 µL

CD81 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details