Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial

This Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial spans the amino acid sequence from region 502-637aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Envelope glycoprotein (GP1,2) (GP) [Cleaved into, GP1, GP2, Shed GP (GP1,2-delta) ]

UniProt

Q7T9D9

Expression Region

502-637aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Sudan ebolavirus (strain Uganda-00) (SEBOV) (Sudan Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulocyte Marker (BM-2), CF568 conjugate, 0.1mg/mL
BNC680062-100 1x 100 µL

Granulocyte Marker (BM-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Langerin / CD207 (Marker of Langerhans Cells) (LGRN/3136R), CF647 conjugate, 0.1mg/mL
BNC473136-100 1x 100 µL

Langerin / CD207 (Marker of Langerhans Cells) (LGRN/3136R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF640R conjugate, 0.1mg/mL
BNC403132-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF568 conjugate, 0.1mg/mL
BNC681706-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL
BNC400949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF568 conjugate, 0.1mg/mL
BNC682125-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details