Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

This Recombinant Mouse Transforming growth factor beta-1 (Tgfb1), partial spans the amino acid sequence from region 279-390aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transforming growth factor beta-1 proprotein [Cleaved into, Latency-associated peptide (LAP), Transforming growth factor beta-1 (TGF-beta-1) ]

UniProt

P04202

Expression Region

279-390aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Apolipoprotein B/ApoB Antibody (APOB/4333) [Alexa Fluor 488]
NBP3-08230AF488 100 µL

Mouse Monoclonal Apolipoprotein B/ApoB Antibody (APOB/4333) [Alexa Fluor 488]

Sign In for Pricing
View Details
Phospho-MEK5 (Ser137) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-5432R-BF680 100 µL

Phospho-MEK5 (Ser137) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Sideroflexin 1 antibody
70R-6522 100 µL

Sideroflexin 1 antibody

Sign In for Pricing
View Details
Mouse Complement Component 5a Receptor 1 (C5aR1) ELISA Kit
BSKM62454-01 48 Tests

Mouse Complement Component 5a Receptor 1 (C5aR1) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Component 5a Receptor 1 (C5aR1) ELISA Kit
BSKM62454-02 96 Tests

Mouse Complement Component 5a Receptor 1 (C5aR1) ELISA Kit

Sign In for Pricing
View Details
MMP16 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-1856R-PerCP-Cy5.5 100 µL

MMP16 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details