Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

This Recombinant Mouse Transforming growth factor beta-1 (Tgfb1), partial spans the amino acid sequence from region 279-390aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transforming growth factor beta-1 proprotein [Cleaved into, Latency-associated peptide (LAP), Transforming growth factor beta-1 (TGF-beta-1) ]

UniProt

P04202

Expression Region

279-390aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HP Rabbit Polyclonal Antibody (HRP)
orb2122556 100 µL

HP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lentiviral human ACTL6A shRNA (UAS) - Lentiviral human ACTL6A shRNA (UAS, RFP) (100)
GTR15096468 1 Vial

Lentiviral human ACTL6A shRNA (UAS) - Lentiviral human ACTL6A shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Tmem200a (NM_001109135) Rat Untagged Clone
RN204533 10 µg

Tmem200a (NM_001109135) Rat Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Nup62 shRNA (UAS) - Lentiviral mouse Nup62 shRNA (UAS) (100)
GTR15175506 1 Vial

Lentiviral mouse Nup62 shRNA (UAS) - Lentiviral mouse Nup62 shRNA (UAS) (100)

Sign In for Pricing
View Details
Biotinylated Anti-4-1BB (atenastobart biosimilar) mAb
12-90061B-100 100 µg

Biotinylated Anti-4-1BB (atenastobart biosimilar) mAb

Sign In for Pricing
View Details
C14orf48 (LINC00521) (NM_152777) Human Tagged Lenti ORF Clone
RC206144L4 10 µg

C14orf48 (LINC00521) (NM_152777) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details