Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipopolysaccharide-binding protein (LBP), partial

This Recombinant Human Lipopolysaccharide-binding protein (LBP), partial spans the amino acid sequence from region 304-414aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lipopolysaccharide-binding protein (LBP)

UniProt

P18428

Expression Region

304-414aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anrukinzumab
HW632066-01 100 µg

Research Grade Anrukinzumab

Sign In for Pricing
View Details
Research Grade Anrukinzumab
HW632066-02 1 mg

Research Grade Anrukinzumab

Sign In for Pricing
View Details
Rabbit Polyclonal Isopeptidase T/USP5 Antibody
NBP2-20838 0.1 mL

Rabbit Polyclonal Isopeptidase T/USP5 Antibody

Sign In for Pricing
View Details
SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier; Phosphate Carrier), Member 25
588720 50 µg

SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier; Phosphate Carrier), Member 25

Sign In for Pricing
View Details
OTC ELISA Kit (Human) : 96 Wells (OKEH01060)
OKEH01060 96 Well

OTC ELISA Kit (Human) : 96 Wells (OKEH01060)

Sign In for Pricing
View Details
pTH (1-84) (human)
4031199.05 0.5 mg

pTH (1-84) (human)

Sign In for Pricing
View Details