Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipopolysaccharide-binding protein (LBP), partial

This Recombinant Human Lipopolysaccharide-binding protein (LBP), partial spans the amino acid sequence from region 304-414aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lipopolysaccharide-binding protein (LBP)

UniProt

P18428

Expression Region

304-414aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig MCP1 Matched Antibody Pair Set [ABP-S-031047]
ABP-S-031047 5 Plates

Guinea pig MCP1 Matched Antibody Pair Set [ABP-S-031047]

Sign In for Pricing
View Details
Ctf8 Double Nickase Plasmid (m)
sc-431981-NIC 20 µg

Ctf8 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
TRAM2 (NM_012288) Human Over-expression Lysate
LS009697-20ug 20 µg

TRAM2 (NM_012288) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Human CD160 Antibody (H7), APC
FHB80813 100 Tests

Anti-Human CD160 Antibody (H7), APC

Sign In for Pricing
View Details
Recombinant HSV HCV Fusion Protein, Untagged, E.coli-500ug
QP12158-500ug 500ug

Recombinant HSV HCV Fusion Protein, Untagged, E.coli-500ug

Sign In for Pricing
View Details
MST1R (Phospho-S1394) Blocking Peptide
orb392816-01 1 mg

MST1R (Phospho-S1394) Blocking Peptide

Sign In for Pricing
View Details