Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (1-29) (rat, mouse)

Galanin receptor agonist; Peptides.

Product Specifications

Product Name Alternative

, 114547-31-8, GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, Galanin (1-29) (rat, mouse)

Purity

> 95% by hplc

Form

Freeze dried solid

Solubility

Soluble to 1 mg/ml in water

Molecular Weight

3164.48 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRS 2578
TRC-M750213-10MG 10 mg

MRS 2578

Sign In for Pricing
View Details
Rat TNF alpha Recombinant Rabbit Monoclonal Antibody [PSH04-71] - BSA and Azide free (Detector)
HA722171 100 µL

Rat TNF alpha Recombinant Rabbit Monoclonal Antibody [PSH04-71] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
RGS7BP Human Gene Knockout Kit (CRISPR)
KN414899 1 Kit

RGS7BP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560373 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
GRAF (ARHGAP26) (Center) Rabbit Polyclonal Antibody
AP15036PU-N 400 µL

GRAF (ARHGAP26) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (UCHT1), Biotin conjugate, 0.1mg/mL
BNCB2473-100 1x 100 µL

CD3e (T-Cell Marker) (UCHT1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details