Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (1-29) (rat, mouse)

Galanin receptor agonist; Peptides.

Product Specifications

Product Name Alternative

, 114547-31-8, GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, Galanin (1-29) (rat, mouse)

Purity

> 95% by hplc

Form

Freeze dried solid

Solubility

Soluble to 1 mg/ml in water

Molecular Weight

3164.48 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AQP12B (C-term) Rabbit Polyclonal Antibody
AP50220PU-N 400 µL

AQP12B (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RCE1 (NM_001032279) Human Over-expression Lysate
LY422291 100 µg

RCE1 (NM_001032279) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565821 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
DECR1 Mouse Monoclonal Antibody [Clone ID: OTI7B11]
CF808951 100 µg

DECR1 Mouse Monoclonal Antibody [Clone ID: OTI7B11]

Sign In for Pricing
View Details
CREB1 Rabbit Polyclonal Antibody
R1309-14 100 µL

CREB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CMPK1 (NM_016308) Human Over-expression Lysate
LC402539 20 µg

CMPK1 (NM_016308) Human Over-expression Lysate

Sign In for Pricing
View Details