Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermus aquaticus DNA mismatch repair protein mutL (mutL), partial

This Recombinant Thermus aquaticus DNA mismatch repair protein mutL (mutL), partial spans the amino acid sequence from region 186-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P96082

Expression Region

186-312aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Thermus aquaticus

Field of Research

Cancer, DNA Damage, Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LFPGAGLKEAARQAFGGLLAERLFPLEKGGAFALEGLLTGPQVSRTRPDLLFLAVNGRPVALPEGVLRAVRRAYRELLPEGHYPVGVLNLSLPPGAYRLRLDARKEEVALSKEAEAFLEEALEEAFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PTGES Protein, N-His
orb2834538-01 20 µg

Recombinant Human PTGES Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PTGES Protein, N-His
orb2834538-02 50 µg

Recombinant Human PTGES Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PTGES Protein, N-His
orb2834538-03 100 µg

Recombinant Human PTGES Protein, N-His

Sign In for Pricing
View Details
NIP7 Rabbit Polyclonal Antibody (Fluoro594)
orb3099216 100 µg

NIP7 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Acetone electronic grade, 99.9%
12312-01 1000 mL

Acetone electronic grade, 99.9%

Sign In for Pricing
View Details
Acetone electronic grade, 99.9%
12312-02 2500 mL

Acetone electronic grade, 99.9%

Sign In for Pricing
View Details