Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermus aquaticus DNA mismatch repair protein mutL (mutL), partial

This Recombinant Thermus aquaticus DNA mismatch repair protein mutL (mutL), partial spans the amino acid sequence from region 186-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P96082

Expression Region

186-312aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Thermus aquaticus

Field of Research

Cancer, DNA Damage, Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LFPGAGLKEAARQAFGGLLAERLFPLEKGGAFALEGLLTGPQVSRTRPDLLFLAVNGRPVALPEGVLRAVRRAYRELLPEGHYPVGVLNLSLPPGAYRLRLDARKEEVALSKEAEAFLEEALEEAFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm6 (BC026129) Mouse Tagged ORF Clone
MR211661 10 µg

Rbm6 (BC026129) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Ceramide glucosyltransferase (UGCG) ELISA Kit
MBS2803935-01 48 Tests

Mouse Ceramide glucosyltransferase (UGCG) ELISA Kit

Sign In for Pricing
View Details
Mouse Ceramide glucosyltransferase (UGCG) ELISA Kit
MBS2803935-02 96 Tests

Mouse Ceramide glucosyltransferase (UGCG) ELISA Kit

Sign In for Pricing
View Details
Mouse Ceramide glucosyltransferase (UGCG) ELISA Kit
MBS2803935-03 5x 96 Tests

Mouse Ceramide glucosyltransferase (UGCG) ELISA Kit

Sign In for Pricing
View Details
Mouse Ceramide glucosyltransferase (UGCG) ELISA Kit
MBS2803935-04 10x 96 Tests

Mouse Ceramide glucosyltransferase (UGCG) ELISA Kit

Sign In for Pricing
View Details
SLC16A11 Recombinant Protein (Human)
RP097077 100 µg

SLC16A11 Recombinant Protein (Human)

Sign In for Pricing
View Details