Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermus aquaticus DNA mismatch repair protein mutL (mutL), partial

This Recombinant Thermus aquaticus DNA mismatch repair protein mutL (mutL), partial spans the amino acid sequence from region 186-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P96082

Expression Region

186-312aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Thermus aquaticus

Field of Research

Cancer, DNA Damage, Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LFPGAGLKEAARQAFGGLLAERLFPLEKGGAFALEGLLTGPQVSRTRPDLLFLAVNGRPVALPEGVLRAVRRAYRELLPEGHYPVGVLNLSLPPGAYRLRLDARKEEVALSKEAEAFLEEALEEAFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2K6 antibody
70R-18386 50 μL

MAP2K6 antibody

Sign In for Pricing
View Details
Rabbit anti-TEAD1 Antibody
DL91142A-01 50 µL

Rabbit anti-TEAD1 Antibody

Sign In for Pricing
View Details
Rabbit anti-TEAD1 Antibody
DL91142A-02 100 µL

Rabbit anti-TEAD1 Antibody

Sign In for Pricing
View Details
AURKB AAV Vector (Human) (CMV)
12870101 1 µg

AURKB AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SAG2
E10-31146 100 µL

Mouse Monoclonal Antibody to SAG2

Sign In for Pricing
View Details
Human Aryl Hydrocarbon Receptor (AHR) ELISA Kit
abx053431 96 Well

Human Aryl Hydrocarbon Receptor (AHR) ELISA Kit

Sign In for Pricing
View Details