Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial

This Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial spans the amino acid sequence from region 512-651aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inter-alpha-trypsin inhibitor heavy chain H3 (ITI heavy chain H3) (ITI-HC3) (Inter-alpha-inhibitor heavy chain 3) (Serum-derived hyaluronan-associated protein) (SHAP)

UniProt

Q06033

Expression Region

512-651aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg7 (NM_028835) Mouse Tagged ORF Clone
MG210108 10 µg

Atg7 (NM_028835) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HSP 40-4 Lentiviral Activation Particles (h)
sc-403819-LAC 200 µL

HSP 40-4 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
IL-1R1/CD121a (AMG 108) discontinued
048289 100 µg

IL-1R1/CD121a (AMG 108) discontinued

Sign In for Pricing
View Details
Goat Olfactory receptor 52B4 (OR52B4) ELISA kit
GTR10470417 96 Well

Goat Olfactory receptor 52B4 (OR52B4) ELISA kit

Sign In for Pricing
View Details
Rat Brain Natriuretic Peptide (BNP) CLIA Kit
abx490572-01 96 Tests

Rat Brain Natriuretic Peptide (BNP) CLIA Kit

Sign In for Pricing
View Details
Rat Brain Natriuretic Peptide (BNP) CLIA Kit
abx490572-02 5x 96 Tests

Rat Brain Natriuretic Peptide (BNP) CLIA Kit

Sign In for Pricing
View Details