Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuron navigator 3 (Nav3), partial

This Recombinant Mouse Neuron navigator 3 (Nav3), partial spans the amino acid sequence from region 77-184aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuron navigator 3 (Pore membrane and/or filament-interacting-like protein 1)

UniProt

Q80TN7

Expression Region

77-184aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RY2 Antibody - C-terminal region : Biotin (ARP63242_P050-Biotin)
ARP63242_P050-Biotin 100 µL

P2RY2 Antibody - C-terminal region : Biotin (ARP63242_P050-Biotin)

Sign In for Pricing
View Details
Prl4a1 Protein Vector (Mouse) (pPM-C-His)
PV219429 500 ng

Prl4a1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ACLA-3 Polyclonal Antibody
MBS7183306 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ACLA-3 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-NF-κB p65 (Ser529) (E3K3J) Rabbit Monoclonal Antibody (Alexa Fluor® 488 Conjugate)
CST 44673S 100 µL

Phospho-NF-κB p65 (Ser529) (E3K3J) Rabbit Monoclonal Antibody (Alexa Fluor® 488 Conjugate)

Sign In for Pricing
View Details
Rat MMP-7 (Matrix Metalloproteinase-7) ELISA Kit
EKF60385 96 Tests

Rat MMP-7 (Matrix Metalloproteinase-7) ELISA Kit

Sign In for Pricing
View Details
ZBBX
495806 100 µL

ZBBX

Sign In for Pricing
View Details