Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuron navigator 3 (Nav3), partial

This Recombinant Mouse Neuron navigator 3 (Nav3), partial spans the amino acid sequence from region 77-184aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuron navigator 3 (Pore membrane and/or filament-interacting-like protein 1)

UniProt

Q80TN7

Expression Region

77-184aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG4A Knockout HAP1 Polyclonal Cells
ARG34640 1 Million

ATG4A Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Col1a2 ORF Vector (Rat) (pORF)
16564016 1.0 µg DNA

Col1a2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
N-Boc-4- (bromomethyl) -2,2-dimethyloxazolidine
SXB48815-01 100 mg

N-Boc-4- (bromomethyl) -2,2-dimethyloxazolidine

Sign In for Pricing
View Details
N-Boc-4- (bromomethyl) -2,2-dimethyloxazolidine
SXB48815-02 1 g

N-Boc-4- (bromomethyl) -2,2-dimethyloxazolidine

Sign In for Pricing
View Details
Sheep Secondary Lymphoid Tissue Chemokine ELISA Kit
MBS743507-01 48 Well

Sheep Secondary Lymphoid Tissue Chemokine ELISA Kit

Sign In for Pricing
View Details
Sheep Secondary Lymphoid Tissue Chemokine ELISA Kit
MBS743507-02 96 Well

Sheep Secondary Lymphoid Tissue Chemokine ELISA Kit

Sign In for Pricing
View Details