Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement decay-accelerating factor (CD55), partial

This Recombinant Human Complement decay-accelerating factor (CD55), partial spans the amino acid sequence from region 35-126aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complement decay-accelerating factor (CD antigen CD55)

UniProt

P08174

Expression Region

35-126aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)
MBS1418718-01 0.02 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)
MBS1418718-02 0.1 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)
MBS1418718-03 0.02 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)
MBS1418718-04 0.1 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)
MBS1418718-05 0.02 mg (Baculovirus)

Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)
MBS1418718-06 0.02 mg (Mammalian-Cell)

Recombinant Shigella dysenteriae serotype 1 Thiamine-phosphate synthase (thiE)

Sign In for Pricing
View Details