Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial

This Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial spans the amino acid sequence from region 19-174aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Triggering receptor expressed on myeloid cells 2 (TREM-2) (Triggering receptor expressed on monocytes 2)

UniProt

Q9NZC2

Expression Region

19-174aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC5 3'UTR Lenti-reporter-Luc Vector
19408081 1.0 µg

ERCC5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SNAP 25 (H-1) : m-IgG1 BP-HRP Bundle
sc-533548 1 Kit

SNAP 25 (H-1) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
SYT1 CRISPR Knock Out 293T Cell Line (Human)
45993141 1x 10^6 Cells / 1.0 mL

SYT1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
IL20 Mouse Monoclonal Antibody [Clone 5E10]
E45M15966V-2 50 µL

IL20 Mouse Monoclonal Antibody [Clone 5E10]

Sign In for Pricing
View Details
TTA-Q6
BA6581-5.1 1 mL (10 mM in DMSO)

TTA-Q6

Sign In for Pricing
View Details
P2RX1 Polyclonal Antibody Bio Conjugated
C90813Bio 100 µL

P2RX1 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details