Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mannose-binding protein C (Mbl2)

This Recombinant Rat Mannose-binding protein C (Mbl2) spans the amino acid sequence from region 19-244aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mannose-binding protein C (MBP-C) (Mannan-binding protein) (Ra-reactive factor polysaccharide-binding component p28A) (RaRF p28A)

UniProt

P08661

Expression Region

19-244aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX5, NT (SSX5, Protein SSX5) (MaxLight 405)
MBS6351460-01 0.1 mL

SSX5, NT (SSX5, Protein SSX5) (MaxLight 405)

Sign In for Pricing
View Details
SSX5, NT (SSX5, Protein SSX5) (MaxLight 405)
MBS6351460-02 5x 0.1 mL

SSX5, NT (SSX5, Protein SSX5) (MaxLight 405)

Sign In for Pricing
View Details
PDE8B antibody
20R-PR078 0.05 mg

PDE8B antibody

Sign In for Pricing
View Details
M6PR 3'UTR GFP Stable Cell Line
TU062821 1.0 mL

M6PR 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
C1QBP ORF Vector (Human) (pORF)
14242011 1.0 µg DNA

C1QBP ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PAX6 Recombinant Rabbit mAb
ARM1128-01 30 µL

PAX6 Recombinant Rabbit mAb

Sign In for Pricing
View Details