Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-28 receptor subunit alpha (IFNLR1), partial

This Recombinant Human Interleukin-28 receptor subunit alpha (IFNLR1), partial spans the amino acid sequence from region 21-228aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)

UniProt

Q8IU57

Expression Region

21-228aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPG5 (NM_020964) Human Tagged ORF Clone
RG219254 10 µg

EPG5 (NM_020964) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal HIV-1 gp120 Antibody (4F4E4) [mFluor Violet 450 SE]
NBP3-06629MFV450 0.1 mL

Mouse Monoclonal HIV-1 gp120 Antibody (4F4E4) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Canine Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 (FKBP2) ELISA Kit
MBS9928485-01 48 Well

Canine Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 (FKBP2) ELISA Kit

Sign In for Pricing
View Details
Canine Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 (FKBP2) ELISA Kit
MBS9928485-02 96 Well

Canine Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 (FKBP2) ELISA Kit

Sign In for Pricing
View Details
Canine Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 (FKBP2) ELISA Kit
MBS9928485-03 5x 96 Well

Canine Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 (FKBP2) ELISA Kit

Sign In for Pricing
View Details
Canine Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 (FKBP2) ELISA Kit
MBS9928485-04 10x 96 Well

Canine Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 (FKBP2) ELISA Kit

Sign In for Pricing
View Details