Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quercus alba Major pollen allergen Que a 1, partial

This Recombinant Quercus alba Major pollen allergen Que a 1, partial spans the amino acid sequence from region 1-50aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major pollen allergen Que a 1 (allergen Que a 1) (Fragment)

UniProt

P85126

Expression Region

1-50aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Quercus alba (White oak)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELMO1 (NM_001039459) Human Tagged Lenti ORF Clone
RC215722L1 10 µg

ELMO1 (NM_001039459) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
2-Aminohex-4-ynoic acid
EBA83475-01 250 mg

2-Aminohex-4-ynoic acid

Sign In for Pricing
View Details
2-Aminohex-4-ynoic acid
EBA83475-02 2.5 g

2-Aminohex-4-ynoic acid

Sign In for Pricing
View Details
Slc14a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6841307 1.0 µg DNA

Slc14a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
SNAI1 Protein Vector (Mouse) (pPB-C-His)
PV232158 500 ng

SNAI1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Microplitis demolitor bracovirus Uncharacterized protein M2 (M2)
MBS1399275-01 0.02 mg (E-Coli)

Recombinant Microplitis demolitor bracovirus Uncharacterized protein M2 (M2)

Sign In for Pricing
View Details